Tutkimusohjekirjan etusivu. Hakemisto erikoisalan, nimen, lyhenteen tai tutkimusnumeron mukaan

Vastasyntyneiden aineenvaihduntasairauksien seulonta, verestä

11759 B -VasSeu1

Tiedustelut

Erityisanalytiikan laboratorio/aineenvaihduntataudit, puh. 040 6356374

Asiantuntijat

apulaisylilääkäri Irina Nagy: irina.nagyatnordlab.fi / 040 6356290 ja erikoistuva lääkäri Sanna Koskela: sanna.koskelaatnordlab.fi / 0406356284

Indikaatiot

Harvinaisten synnynnäisten aineenvaihduntasairauksien seulonta.

Esivalmistelu

Suostumus näytteenottoon vastasyntyneeltä pyydetään raskausaikana äitiysneuvolassa tai synnytyssairaalassa. Suostumus annetaan suullisesti.

Tutkimusta tilatessa osasto täyttää seuraavat PAKOLLISET lisätiedot:

1. Raskauden kesto (rvk. esim 30)

2. Syntymäpaino (g)

3. Syntymäpäivä ja TARKKA syntymän kellonaika (esim. 10:08)

4. Ravitsemus (valitaan sopiva vaihtoehto tai kirjoitetaan tekstinä)

5. Verensiirtotiedot (lopetuspäivä ja kellonaika)

6. Ei pakollisia ovat kliiniset esitiedot, tarvittaessa (esim. tautiepäilyssä)

Suoritus

OHJE COVID-19 EPIDEMIAN AIKANA: Vastasyntyneiden seulontanäytteitä (B-VasSeu1 ja B-Vasseu2) voi tilapäisesti ottaa jo 36 tunnin ikäisistä vastasyntyneistä. Tällä pyritään välttämään lapsen ja vanhempien altistumista uudella laboratoriokäynnillä sekä toisaalta varmistamaan seulontanäytteen ottaminen jo sairaalassa. Tuloksiin tulee kommentti, jossa todetaan että näytteenotossa on poikettu suositellusta (48-120 tuntia).

EDELLINEN OHJE: näyte otetaan ENSISIJAISESTI ihopistosnäytteenä kantapäästä (esim. kanyylista otettu näyte ei kelpaa) kun lapsi on vähintään 48 tunnin (2vrk) ikäinen ja enintään 120 tunnin ikäinen (5 vrk).

HUOM! Verensiirron jälkeen näyte voidaan ottaa vasta 24 tunnin kuluttua ja verenvaihdon jälkeen 3 vrk kuluttua. Verinäyte otetaan ENSISIJAISESTI puhtaalla, ei-heparinisoidulla kapillaarilla (100 µl) ja pipetoidaan näytteenottokortin näyteympyräalueille. Ympyrään ei lisätä näytettä. Jos näytteenotossa on ollut vaikeuksia (esim. näyte ei otettu kapilaarilla), näytekorttiin voi kirjoittaa ko. näytetäplän viereen.

Ks. Näytteenotto-ohjeet erillisestä ohjeesta, Weblab Clinicalissa kohdassa WWW-linkki, ja NordLab internetissä osoitteessa:

https://www.nordlab.fi/sites/default/files/pdf_uploads/vasseu.pdf

Näyteastia

Näytekortti

Menetelmä

Nestekromatografia-tandem-massaspektrometria, immunofluorometria ja PCR. Alihankintana teetettävä tutkimus:

https://webohjekirja.mylabservices.fi/TYKS/index.php?test=13231

Tulokset valmiina

1-2 viikon kuluttua näytteen saapumisesta Saskeen. Ota yhteyttä Saskeen, mikäli toivot jonkin näytteen kiireellistä käsittelyä.

Yleistä

Synnynnäiset aineenvaihduntasairaudet ovat harvinaisia, periytyviä sairauksia. Useimmat näitä sairauksia sairastavat lapset vaikuttavat vastasyntyneinä täysin terveiltä. Näitä sairauksia etsitään seulontatutkimuksella, jotta hoito pystyttäisiin aloittamaan ennen oireiden ilmaantumista ja pysyvien vaurioiden kehittymistä. Usein hoito on erityisruokavalio. Eräissä vakavissa synnynnäisissä aineenvaihduntasairauksissa nopeasti aloitettu hoito voi estää kehitysvammaisuuden tai muiden vaikeiden ongelmien kehittymisen. Ennuste riippuu oleellisesti siitä, paljonko vaurioita on ehtinyt syntyä ennen hoidon aloitusta. Vain tutkimalla kaikki vastasyntyneet löydetään varmasti ne sairaat lapset, joille varhainen taudin tunnistaminen ja hoidon aloitus ovat elintärkeitä.

B-VasSeu1 tutkimuksessa seulottavia sairauksia ovat:

Aminohappojen aineenvaihdunnan sairaudet: Fenyyliketonuria (PKU), homokystinuria, hyperornitinemia-gyrata-atrofia (HOGA-tauti), tyrosinemia tyyppi 1 ja vaahterasiirappitauti (MSUD).

Endokrinologiset sairaudet: Synnynnäinen lisämunuaisen liikakasvu (CAH).

Orgaanisten happojen aineenvaihdunnan häiriöt: Synnynnäinen B12-vitamiinin puutos, glutaarihappovirtsaisuus tyyppi I (GA I), isovaleerihappovirtsaisuus, metyylimalonihappovirtsaisuus ja propionihappovirtsaisuus.

Rasvahappojen aineenvaihdunnan häiriöt: CACT (karnitiini-asyylikarnitiinitranslokaasin puutos), CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I, CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II, CUD (karnitiinin kuljetushäiriö), glutaarihappovirtsaisuus tyyppi II (GA II), MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos), LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency) ja VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos).

Ureasyklin häiriöt: Sitrullinemia, arginiinimeripihkahappouria (ASA-uria) ja argininemia.

Vaikea kombinoitu immuunivaje (SCID).

Tarkkoja tietoja kaikkien näiden tautien yleisyydestä Suomessa ei ole, mutta on arvioitu, että vuosittain Suomessa syntyy noin 10-20 lasta, joilla on jokin tämän ryhmän tauti. Suuri osa aineenvaihduntasairauksista on peittyvästi periytyviä, jolloin perintötekijämuutos eli mutaatio siirtyy terveiden kantajien välityksellä sukupolvesta toiseen. Sairaus ilmenee kun lapsi perii tautimutaation sekä äidiltä että isältä, joista kumpikin on terve tautimutaation kantaja. Lapsen sairaus onkin lähes aina yllätys, koska kummankaan vanhemman suvussa ei useimmiten ole todettu sairautta aikaisemmin.

Tulkinta

Ammattilaisille: Mikäli aineenvaihduntaseulonnan tulos on poikkeava, seulontakeskus (Saske) ilmoittaa tuloksesta ja antaa ohjeet tarvittavista jatkotoimenpiteistä puhelimitse hoitavalle lääkärille. Tällöin otetaan tarvittaessa kontrollinäyte.

Mikäli SCID-seulontatulos eli TREC-kopioluku on poikkeavan matala, seulontakeskus (Saske) ilmoittaa tuloksesta ja antaa ohjeet tarvittavista jatkotoimenpiteistä puhelimitse hoitavalle lääkärille. Tällöin otetaan tarvittaessa uusi verinäyte (B-VasTREC 11738).

Perheille: Tilanteissa, joissa tulos on normaali: tulokset siirtyvät vauvan potilastietotietoihin. Perheeseen ei oteta yhteyttä.

Tilanteissa, joissa tulos on poikkeava: perheeseen otetaan yhteyttä synnytyssairaalasta.

Katso seulonnan kulku Saske-laboratorion sivuilta: https://www.vsshp.fi/fi/saske/perheille/seulonnan-kulku/Sivut/default.aspx

Huomautuksia

Tutkimus otetaan käyttöön 1.6.2021 alkaen ja korvaa kokonaan tutkimuksen B-VasSeu2 (nro 11373).

Päivitetty 07.06.2021 / SK

Sivun alkuun