Tutkimusohjekirjan etusivu. Hakemisto erikoisalan, nimen, lyhenteen tai tutkimusnumeron mukaan

Vastasyntyneiden aineenvaihduntasairauksien seulonta, ilman hypotyreoosiseulontaa, verestä

11373 B -VasSeu2


Erityisanalytiikan laboratorio/aineenvaihduntataudit, puh. 040 6356374


erikoislääkäri Päivi Myllynen: paivi.myllynenatnordlab.fi / 040 635 6386 ja erikoislääkäri Irina Nagy: irina.nagyatnordlab.fi / 040 6356290


Harvinaisten synnynnäisten aineenvaihduntasairauksien seulonta.


Suostumus näytteenottoon vastasyntyneeltä pyydetään yleensä raskausaikana äitiysneuvolassa. Suostumus voidaan antaa sähköisesti tai paperisella suostumuskaavakkeella, jolloin allekirjoitettu suostumuskaavake kiinnitetään neuvolakorttiin.

Suostumuskaavake suomeksi: http://www.nordlab.fi/sites/default/files/pdf_uploads/suostumusasiakirja_suomi_vasseu2_oys_erva-korjattu.pdf

Suostumuskaavake ruotsiksi: http://www.nordlab.fi/sites/default/files/pdf_uploads/suostumusasiakirja_ruotsi_vasseu2_oys_erva-korjattu.pdf

Suostumuskaavake englanniksi: http://www.nordlab.fi/sites/default/files/pdf_uploads/vasseu2-suostumus-english-_korjattu.pdf

Tutkimusta tilatessa osasto täyttää lisätiedot:

1. Raskauden kesto 2. Syntymäpaino 3. Syntymäpäivä ja -aika 4. Verensiirtotiedot 5. Ravitsemus 6. Kliiniset esitiedot tarvittaessa (esim.tautiepäily)


Näyte otetaan ENSISIJAISESTI ihopistosnäytteenä kantapäästä (esim. kanyylista otettu näyte ei kelpaa) kun lapsi on vähintään 48 tunnin (2vrk) ikäinen ja enintään 120 tunnin ikäinen (5 vrk).

HUOM! Verensiirron jälkeen näyte voidaan ottaa vasta 24 tunnin kuluttua ja verenvaihdon jälkeen 3 vrk kuluttua. Verinäyte otetaan ENSISIJAISESTI puhtaalla, ei-heparinisoidulla kapillaarilla (100 µl) ja pipetoidaan näytteenottokortin näyteympyräalueille. Ympyrään ei lisätä näytettä. Jos näytteenotossa on ollut vaikeuksia (esim. näyte ei otettu kapilaarilla), näytekorttiin voi kirjoittaa ko. näytetäplän viereen.

Ks. Näytteenotto-ohjeet erillisestä ohjeesta: Weblab Clinicalissa kohdasta WWW-linkki ja Internetissä osoitteesta http://www.nordlab.fi/sites/default/files/pdf_uploads/naytteenotto_vasseu2_0.pdf




Nestekromatografia-tandem-massaspektrometria ja immunokemia. Alihankintana teetettävä tutkimus:


Tulokset valmiina

2-3 viikon kuluessa


Synnynnäiset aineenvaihduntasairaudet ovat harvinaisia, periytyviä sairauksia. Useimmat näitä sairauksia sairastavat lapset vaikuttavat vastasyntyneinä täysin terveiltä. Näitä sairauksia etsitään seulontatutkimuksella, jotta hoito pystyttäisiin aloittamaan ennen oireiden ilmaantumista ja pysyvien vaurioiden kehittymistä. Usein hoito on erityisruokavalio. Eräissä vakavissa synnynnäisissä aineenvaihduntasairauksissa nopeasti aloitettu hoito voi estää kehitysvammaisuuden tai muiden vaikeiden ongelmien kehittymisen. Ennuste riippuu oleellisesti siitä, paljonko vaurioita on ehtinyt syntyä ennen hoidon aloitusta. Vain tutkimalla kaikki vastasyntyneet löydetään varmasti ne sairaat lapset, joille varhainen taudin tunnistaminen ja hoidon aloitus ovat elintärkeitä. B-VasSeu2 tutkimuksessa seulottavia sairauksia ovat

Aminohappojen aineenvaihdunnan sairaudet: Fenyyliketonuria (PKU), homokystinuria, hyperornitinemia-gyrata-atrofia (HOGA-tauti), tyrosinemia tyyppi 1 ja vaahterasiirappitauti (MSUD)

Endokrinologiset sairaudet: Synnynnäinen lisämunuaisen liikakasvu (CAH)

Orgaanisten happojen aineenvaihdunnan häiriöt: Synnynnäinen B12-vitamiinin puutos, glutaarihappovirtsaisuus tyyppi I (GA I), isovaleerihappovirtsaisuus, metyylimalonihappovirtsaisuus ja propionihappovirtsaisuus.

Rasvahappojen aineenvaihdunnan häiriöt: CACT (karnitiini-asyylikarnitiinitranslokaasin puutos), CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I, CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II, CUD (karnitiinin kuljetushäiriö), glutaarihappovirtsaisuus tyyppi II (GA II), MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos), LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency) ja VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos).

Ureasyklin häiriöt: Sitrullinemia, arginiinimeripihkahappouria (ASA-uria) ja argininemia

Tarkkoja tietoja kaikkien näiden tautien yleisyydestä Suomessa ei ole, mutta on arvioitu, että vuosittain Suomessa syntyy noin 10-20 lasta, joilla on jokin tämän ryhmän tauti. Suuri osa aineenvaihduntasairauksista on peittyvästi periytyviä, jolloin perintötekijämuutos eli mutaatio siirtyy terveiden kantajien välityksellä sukupolvesta toiseen. Sairaus ilmenee kun lapsi perii tautimutaation sekä äidiltä että isältä, joista kumpikin on terve tautimutaation kantaja. Lapsen sairaus onkin lähes aina yllätys, koska kummankaan vanhemman suvussa ei useimmiten ole todettu sairautta aikaisemmin.


Normaalit tulokset vastataan "Normaali". Normaalista tuloksesta ei toistaiseksi ilmoiteta perheelle. Poikkeavasta seulontatuloksesta annetaan erillinen lausunto, ja lastenlääkäri ottaa yhteyttä perheeseen. Lääkäri tutkii lapsen ja hänestä otetaan uusi näyte. Jatkotutkimuksilla varmistetaan seulontatutkimuksen tulos.

Päivitetty 12.12.2018 / IN

Sivun alkuun